Query Sequence
>GFF233
MKIAVLSRNPRLYSTRRLVEAGTERGHEMVVIDTLRAYMNIASHKPQIHYRGKPLEGFDAVIPRIGASVTFYGCAVLRQFEMMGVFPLNESVAIARSRDKLRSLQLLSRRGIGLPVTGFAHSPDDIPDLIDMVNGAPLVIKVLEGTQGIGVVLCETATAAESVIEAFMGLKQNIMVQEYIKEAGGADIRCFVVGDKVIAAMKRQAKPGEFRSNLHRGGSASLIKITPEERMTALRAAKVMGLSVAGVDILRSNHGPLVMEVNSSPGLEGIETTTGKDVAGIIIQHLEKNGGPNMTRTKGKG
Hit FamilyFIG00001180
Hit Family FunctionRibosomal protein S6 glutaminyl transferase


back to search