Query Sequence
>GFF2323
MSETWNKRTKLVHGGTRRSQYNEVSEAIYLTQGFVYDTAEQAEARFIETGPDEFIYARYGNPTVAMFEERIAALEGAEDAFATASGMAAVNGALTSILKAGDHVVSAKALFGSCLYILENILTRYGVEVTFVDGTDLDAWRAALRPDTKAVFFESMSNPTLEVIDIAAVAELAHAVGATVVVDNVFSTPVFSNAIEQGADVVIYSATKHIDGQGRVLGGVILGTRDFIRGTVEPYMKHTGGSLSPFNAWTLLKGLETISLRVNAQAETALELAQALSGHPALSRLMYPGLEDHAQHALVQRQLGGKGGTVLSLDLKGGKDAAFRFLNALTIPVISNNLGDAKSIATHPATTTHQRLSEELKSELGITPGLVRFSVGLEDAGDLIADLTQALAVAEG
Hit FamilyFIG00963163
Hit Family FunctionO-acetylhomoserine sulfhydrylase (EC 2.5.1.49)


back to search