Query Sequence
>GFF2307
MSTHLSTDQLLHAYTVMRTIRDFEERLHVEFATGEIPGFVHLYAGQEASAAGVMAHLNDEDCIASNHRGHGHCIAKGVDVFGMMAEIYGKKTGVCGGKGGSMHIADQEKGMLGANGIVGAGAPLAAGAALASKLKGSQGVAVAFFGDGGSNEGAVFEAMNLASIMKLPCLFVAENNGYAEATGSGWSVACKDIAERAVGFGMPGVIVDGNDFFAVHAALGVAVERARKGDGPTLVEVKLSRFYGHFEGDAQTYRGPDEVKNLRENADCLALFRQRCSAEGWLDAAQFERIDGEVAQLIEDAVRLAKSDPKPQAADLLSDVYVAYP
Hit FamilyFIG00138523
Hit Family FunctionAcetoin dehydrogenase E1 component alpha-subunit (EC 1.2.4.-)


back to search