Query Sequence
>GFF2187
MIKKCLFPAAGYGTRFLPATKAMPKEMLPVVNKPLIQYGVEEALAAGLNQIAIVTGRGKRSLEDHFDISYELEHQIRNTDKEKYLVGIRRLIDECSFSYTRQVEMKGLGHAILSGRPLIGDEPFAVVLADDLCINLDGDPVLAQMVKLYNQFRCSIVAIQEVPPEETSKYGVIAGEMIRDDIYRVSHMVEKPKPEDAPSNMAIIGRYILTPDIFDLIEQTEPGKGGEIQITDALMRQAQDGCVLAYKFKGQRFDCGSAEGYIAATNFCYEHFYLTGKAF
Hit FamilyFIG00000108
Hit Family FunctionUTP--glucose-1-phosphate uridylyltransferase (EC 2.7.7.9)


back to search