Query Sequence
>GFF2124
MPTAPAPATNEAIAALYHKLNWRLLPLLFIGYVFAYLDRINVGFAKLQMQSDLGLSDAAYGAGAGIFFVGYVLFELPSTLMLPRIGARKTFSRILVLWGITSACMLFVRDVPTFYAMRFLLGVFEAGFAPGMIYYLSRWYGPSRMARAIAIVFIAGPMGGILGGPISAWLITTFAGVGGLAGWQWMFLIEGLPCVFLGVLMYVVLCDRPADAPWLNAAEKQLLETELGTASARSHSFRTVLRDPKLYVLASAYFCIIFSIYAMSFWLPAVIKALGVNDTQQLGWYAALPYVGAALGMYWIGRRSDRLGERRLHCAIPAATGAVLLILYPLAGGNLLVSMALLTLSISMMFMAYTVLWAMPSEHIKGEAAAGGIALINTIGLSGGFWGPAMIGWAKTATGSLDTGLIAVGCVFLCAAFVIIATTPRTRTGQTGDYIRSH
Hit FamilyFIG00005529
Hit Family FunctionNitrate/nitrite transporter


back to search