Query Sequence
>GFF210
MDLSCFKAYDLRGRVPDQLNPVLAEKIGRAYVEITGAKKVIVGYDIRLSSPDIAEALSSGLMAAGADVFDIGLCGTEQVYFATSHYKMDGGIMVTASHNPKDHNGMKMVGPESRPISSDNGLNEIRDRVLEPFGDAPQQGRYEPLEVMSAYVDHLLGYIDAGSLSPLTIVCNAGNGGAGLVIDELEQHLPFEFVKVHHQPDGHFPNGVPNPILPENRAATADAVIAEGAAMGIAWDGDYDRCFFFDENGRFIEGYYIVGLLADQFLRKTGGGKVIHDPRLTWNTMDLVKAAGGEAIESKTGHAFIKQRMRDEDAVYGGEMSAHHYFRDFAYCDSGMIPWLLVAERLCQSGQTLSSLIDARIEAYPASGEINRTIDDPPKVIAAIEAKYSVGAKSVSHVDGVSIEFDDWRFNLRMSNTEPVVRLNVESRADIPLMEEKTEELLAEMQRLNEER
Hit FamilyFIG00001022
Hit Family FunctionPhosphomannomutase (EC 5.4.2.8)


back to search