Query Sequence
>GFF1918
MNFKSNLLAGVATLAMTSAATADGIRAEVIHWWVSAGEAAAIKVFADAYTANGGEWIDNGIGGGGAKTTFVNRLMGGDAPQVGQFNTSREFEEIVDAGLLHSLDAEAEAGNWSALFPGIIDNVVKRDGSYYAVPVNIHGSNWLWHNNQVMADAGLDVPTDWDSFFEAAETLKEAGIIPLAVGGEAWQERLTFNSVLLSVGGQDLYLRLFEEKDTTALTSDEMKEVFDVYSRLRTLVRETDPGSPGRSWNDATNMVITGQAAMQIMGDWAKGEFLSAGMTPGVEYGCTPAVIAGSPYMISGDVFVFPKTGNEEDREAQSLMATTMLDAEVQVAFNNIKGSIPVRPDVDTSQLDVCGQQAIALTSNPDTHVGVTQMYISSDLAGALQDVYTQFWNSETMTTEEAITLLSQAYEIAG
Hit FamilyFIG01316113
Hit Family FunctionABC-type sugar transport system, periplasmic component


back to search