Query Sequence
>GFF1916
MTNFDTIAASGPKPTRRSMRRIAIYVFLSVAAAFFLMPIYIVIVTSLKTMPEIRLGNVLQWPQTWSVDAWIKAWDTACTGLQCEGIKVGFWNSMRILLPSLVVSITAGALCGYILTFWTFRGAEIFFAILLFGAFVPYQALIFPMIRIFSATGLYGTLPGIVLVHTIFGLPIMTLIFRNYYSTLPSEIFKAARVDGAGFFSVFWYVLLPISTPIIVVAAILQVTGIWNDYLLGLIFGGRENMPMTVQLNNIVNSVRGGKEYNVNMAATLLTALVPLTVYFVSGRWFVRGIAAGAVKG
Hit FamilyFIG00005339
Hit Family FunctionABC-type sugar transport system, permease component


back to search