Query Sequence
>GFF1858
MSSIALQARPAKASPLDALQRWLPKLVLAPSMLIVLVGFYAYIGWTFLLSFTNSRFMPSYKWVGLQQYERLWDNDRWWVASQNLLVFGGLFIAVSLIIGVVLAVLLDQRIRREGLIRTIYLYPMALSMIVTGTAWQWLLNPGLGLDKLLRDWGWEGFRFDWLVDPDRVIYCLVIAAVWQASGFVMALFLAGLRSVDQSIIRAAQVDGASLPTIYLRIVLPSLRPVFFSALMILAHIAIKSFDLVAAMTAGGPGYSSDLPAMFMYAHTFTRGQMGLGAASAMLMLGAVMAIIVPYLYSELRNKRHV
Hit FamilyFIG00148781
Hit Family FunctionGlucose ABC transport system, inner membrane component 1


back to search