Query Sequence
>GFF1754
MKVLKSQDVLALGFMTFALFVGAGNIIFPPIVGLQSGPHVWMAALGFLVTAVGLPVVTVIALAKVGGGMDALSSPIGKIAGGLLAAAAYLAVGPLFATPRTATVSFEVGLAPLTGESPLALFLYSSVYFLVVFFVSLYPGRLLDTVGRFLAPLKIIALAILGIAAFALPAGDVGVATQEYVAAPFSQGFINGYLTMDTLGALVFGIVIVNAIRSRGVESPKLITRYAIIAGLIAGVGLALVYISLFRLGSGSHEVAAGAANGAAVLHAYVQHTFGSLGSGFLAVLISLACLVTAVGLTCACAEYFSRILPLSYKTLVVILALFSLFVSNLGLTKLIAFSIPVLTAIYPPCIVLVALSFCKDFWLEQGRIVGPVMLVSFIFGCIDALKGAGLADWMPAQLANLPLSEQGLAWLVPSVMTLAVAFAVDRMLGKRSEAIA
Hit FamilyFIG00905542
Hit Family FunctionBranched-chain amino acid transport system carrier protein


back to search