Query Sequence
>GFF1674
MTDTKKTAQLSLNGETYELPIFSPTTGPDVLDIRKLYGQAGVFTYDPGFTSTASCDSTITYIDGGKGELLHRGYPIDQLASKSHHLEVCYLLLYGELPTAAQLEDFETRVTRHTMVHEQMHNFFRGFRRDAHPMATLVGVVGAMSAFYHDSTDINDPWQREVAAIRLIAKLPTIAAMAYKYSIGQPFVYPRNDLDYAANFLHMCFSVPAEEYHVDPILARAMDRIFILHADHEQNASTSTVRLASSSGANPFACIAAGIACLWGPAHGGANQACLEMLKEIGSVDRIPEFIERAKDKNDPFRLMGFGHRVYKNTDPRAKVLKQSADEVLELLGVENNPLLQVAKELERTALNDEYFIEKKLFPNVDFYSGIILEAMGFPTSMFTPIFALSRTVGWISQWKEMIADPQNKIGRPRQLYLGETARDYIDIESR
Hit FamilyFIG00130344
Hit Family FunctionCitrate synthase (si) (EC 2.3.3.1)


back to search