Query Sequence
>GFF1626
MAVYNYDLVVLGSGPAGEGAAMNAVKAGRKVAVVDNRPLVGGNCTHLGTIPSKALRHSVRQIMQYNTNPLFRQIGEPRWFSFPDVLKSAEKVISKQVTSRTGYYARNRIDTFFGTASFSDEQSVEVVCLNGMVEKLVASQFVIATGSRPYRPADVDFSHPRIYDSDTILTLSHTPRRMIIYGAGVIGCEYASIFSGLGVLVDLIDNREQLLSFLDDEISDALSYHLRNNNVLIRHNEEYERVEGLENGVILHLKSGKKIKADAFLWSNGRTGNTDKLGLENIGLKANSRGQIQVDEHYRTEIGNIYAAGDVIGWPSLASAAYDQGRSAAGSIVENDSWRFVDDVPTGIYTIPEISSIGKNERELTQAKIPYEVGKAFFKSMARAQISFEPVGMLKILFHRETLEVLGVHCFGYQASEIVHIGQAIMNQKGPANSIKYFVNTTFNYPTMAEAYRVAAFDGLNRLF
Hit FamilyFIG00001482
Hit Family FunctionSoluble pyridine nucleotide transhydrogenase (EC 1.6.1.1)


back to search