Query Sequence
>GFF1617
MTQPSDKALVPFVSVDNMMRLIHHVGIDTVMKDLATYIEEDFKRWELFDKTPRVASHSDVGVIELMPTSDGEAYGFKYVNGHPKNTSEGLQTVTAFGLLADVYTGYPVLLTEMTILTALRTAATSAMVAKHLAPKGATTMAMIGNGAQSEFQSLAMQAICGLKSVRLYDVDPAATAKCAANLAGTGLAVVSCKTPEEAIEGAQILTTCTADKQYATILTDNMVGSGVHINAIGGDCPGKTELAPGILSRSDVFVEFPPQTRVEGEIQQMPEDFEVTELWQVILGQKPGRRDDKQITLFDSVGFAIEDFSALRYIRDRIKDTDFFLELDMLADPDDPRDLFGMVQRAKG
Hit FamilyFIG00000614
Hit Family FunctionOrnithine cyclodeaminase (EC 4.3.1.12)


back to search