Query Sequence
>GFF1587
MSLLQVRDLSVIANNAGRDVTLVDRVSFDLAEGEILGLVGESGSGKTMACRGLMRLLPSPNLRVQGGAVRLGGQDLLSLDDAGMRAVRGGQLGMIFQNPSSHLDPLMRIGEQIAEGIRLHQGASKKDARLQAIEVLRQVGIPDPQARVDNYPQEFSGGMRQRAMIAVALGCNPKVLIADEPTTALDVTVQAQILRLLLELRDQRGLSIIMITHDLGVVAQTCDAIAVMYAGCLCEHGSKYDVLAQPQHPYTAGLIDCQPAHSSGHALLRTIPGQPPLLDALPAGCRFNPRCPQVGALCTEVLPEGQRVACHYPLGAQP
Hit FamilyFIG00945384
Hit Family FunctionOligopeptide transport system permease protein OppB (TC 3.A.1.5.1)


back to search