Query Sequence
>GFF1561
MSDKYDVIVIGAGPGGYVAAIKAAQLGLKTACVESWTSEDGKAQVLGGTCLNVGCIPSKALLEISHKFEESSHDFEMQGIIAKDVKMDIGKMMERKSGIVKQLTGGIAGLFKSNGVTSIHGHGKLLANRKVEVTDKDGKSKTYEAENIILATGSKPIQIPPAPFDGEYIVDSEGALEFTEVPKRLGVIGAGVIGLELGSVWARLGAEVTVLEAQDTFLPAVDQQVAKDALKQFQKQGLNIVMGARMTGAEVKRKLVNVNYEDSKGKHEAKFDKLIVAVGRRPYTDNLLSEDSGVQMDERGFIFVDDNCKTEAPGVWAIGDVVRGPMLAHKASEEGIMVAERIAGHKPQVNYDCIPNVVYTFPEVAWVGKTEEQMKAEGEEYNVGTFPFAANGRAMAANSASGLVKIIADAKTDRIVGFHVVGPQASEIVAQGVIAMEFGSSAEDLALTCFAHPTLSESVHEAALAVGGGAIHIANRRKKK
Hit FamilyFIG00013010
Hit Family FunctionDihydrolipoamide dehydrogenase of 2-oxoglutarate dehydrogenase (EC 1.8.1.4)


back to search