Query Sequence
>GFF152
MSERTAYVERNTLETQVKVTINLDGTGKARFAIGVPFLEHMLDQIARHGLIDLDIECNGDLHIDDHHTVEDVGITLGQAFIKAIGDKKGMTRYGHSYVPLDEALSRVVIDFSGRPGLTMNVPYTRAVVGKFDVDLFQEFFQGFVNHALVTLHIDNLRGINTHHQIETVFKAFGRALRMAVELDPRMAGQMPSTKGCL
Hit FamilyFIG00000601
Hit Family FunctionImidazoleglycerol-phosphate dehydratase (EC 4.2.1.19)


back to search