Query Sequence
>GFF1390
MTTAVKERKLTVARAMAEAVAQEMRLDPKVFVMGEDIGQLGGVFGNTRGLYEEFGKTRIRDTPISETAFIGAAVGAASDGMRPIVELMFVDFFGVCMDAIYNLMAKNTYFSGGKVPVPMVLMASTGAGYSDAGQHSQCLYGTFAHLPGMKVVVPSNAYDAKGLMTAAIRDDNPVVYLFHKALQGMGWLGTEKGATVPVPEEPYIVEIGKAKTVREGRDVSLVSLGAGVHHALRAAAQLEKDGVSAEVIDLRSLVPLDREHVIASVRKTGRLIVIDEDYHSFGVSGEIIASVVEHDIGMLKARPQRVAFPDIPIPFTPVMEQWALPNADKIVAAYHAMHKE
Hit FamilyFIG01256920
Hit Family FunctionAcetoin dehydrogenase E1 component beta-subunit (EC 1.2.4.-)


back to search