Query Sequence
>GFF1139
MPVAQINILEGRSDEQKEMLIREVTDAISRSLGAPVESIRIIITEMPKQHFGIGGQSAKMLGR
Hit FamilyNo hits found for this sequence


back to search