Query Sequence
>GFF1138
MSKTLSQEQVLALAEHVENAELQAHDITKVTNDFPDMTFEDAYDVQWEIRRRKEARGNKIVGMKMGLTSWAKMAQMGVETPIYGFLADYFSVPDGGVVNTKELIHPKIEAEIAFVTKAPLKGPGCHIGQVLAATDFVIPAVEVIDSRYENFKFDLVSVVADNASSTRFITGGQMADVADVDLKTLGVVVEKNGEVVDVGAGAAVLGHPASSVAMLANLLAERGEHIPAGTFIMTGGITAAITVEPGDNITVRYQGLGTVSARFE
Hit FamilyFIG00133921
Hit Family Function4-oxalocrotonate decarboxylase (EC 4.1.1.77)


back to search