Query Sequence
>GFF1134
MTVPEKSPEIGREITAAGYRTNVHDHGEGGVPVMMIHGSGPGVTAWANWRLVIPELAKNRRVVAPDMLGFGYSERPEDQIYNRERWVKHAIGVMDELGLEQVDLVGNSFGGGLALALAIEHPKRIRRLVLMGSAGVRFPITEGLDEVWGYEPSLDNMRRLMDVFAFNKGLLTDELAEMRYEASIRPGFQESFAAMFPAPRQRWVDNLASNEDDIRALTHETLIIHGREDEVIPLEASLRLAELIDRAQLHVFGRCGHWTQIEHADRFARLVNDFLTEADQAAVGGN
Hit FamilyFIG00042074
Hit Family Function2-hydroxymuconic semialdehyde hydrolase (EC 3.7.1.9)


back to search