Query Sequence
>Echvi_4609
MSSTKFDVIVVGSGPGGYVAAIRASQLGLKTAVVEAAELGGICLNWGCIPTKALLKSAQVFEYINHAKDYGITVKDPKADFGGMVKRSRGVADGMSKGIQFLLKKNKIEQLLGWGKVKPGKKVEVEDKDGKKTTYSADNIIIATGARSRELPAIKIDDKKIIGYRKAMTLEKQPKKMVVVGSGAIGVEFAYFYAAIGTEVTVVEFMDRIVPNEDAEVSKALERMYKKAGMNIMTSTEVTSVDTKGSGCKVTVKTKKGEETIDCDVVLSAAGVVANVENCGLEDVGIVVDKGRIKVDEFYKTNMPGYYAIGDVIPGPALAHVASAEGIICVEKIAGHDPEPLDYNNIPGCTYCVPEIASVGYTEEKAKEAGYELKVGKFPFSASGKAKAAGASDGFVKLIFDAKYGELLGAHMIGANVTEMIAEIVAVRKLETTGHELIKTVHPHPTMSEAVMEAAAAAYDEVIHL
Hit FamilyFIG00140039
Hit Family FunctionDihydrolipoamide dehydrogenase of branched-chain alpha-keto acid dehydrogenase (EC 1.8.1.4) / Dihydrolipoamide dehydrogenase (EC 1.8.1.4)


back to search