Query Sequence
>Echvi_3112
MMISAENIHFCIQKRPILDQVDLQIYPGEVLTILGPNGAGKSTLLKLLSGENTCDTGKISINQVLLQQLKPRQLAKYRAVMPQHSSVNFPYTVEEIIALGKLAHDPHSSSDQLMEEVMDITGTAALRERMIKGLSGGERQRVHLARALLQIWEDKPYARYLLLDEPTSSMDIAQQHQVLRLLRFLRQRNIGVLTILHDLNLAAQYSDKVMLMKDGKVVGFGPTSAIMTATKLSHVYGHPISVMSHPMDEKQVVITSETTSNNHTYASFKTA
Hit FamilyNo hits found for this sequence


back to search