Query Sequence
>Echvi_2919
MNNRQLFLSNLAQTTDFPLLIEIEKAEGIYMYGPKGEKYIDLISGIGVSNVGHRHPKVLKAIQDQLDKYMHLMVYGEYVQSPQTQLAKALTDTLPKKLDNVYLVNSGSEAVEGALKLAKRYTGRREILSCVNAYHGSSHGALSVGGNEIFKRAYRPLLPGIRHLDFNEPDQLDQITEETAAIMVETVQGEAGIRVGTKEYFKALRHRCDETGTLLILDEIQAGFGRTGKFWAFQHYDIVPDIVVCAKGMGGGMPIGAFIAPQSIMSVFKNNPLLGHITTFGGHPVSCAAALATIDILRDEKLIQHVERKANLFKKHLNHPKIQEIRNKGLMMAVKFEAFEVLKPIIDRAIELGIITDWFLFCEDSMRIAPPLTITDEEIEKACAIILQSIDEN
Hit FamilyFIG01344113
Hit Family FunctionAcetylornithine aminotransferase (EC 2.6.1.11) (ACOAT)


back to search