Query Sequence
>Echvi_2517
MENLKIDFDKVNGLVPAIIQDATTNAVLMLGYMNEEALQKTQESGKVTFFSRTKQRLWTKGETSGNFMHVQSIKVDCDNDTLLIKADPVGPVCHTGADTCFDEKNTSKTAFIDQLRSIIKDRKNNPTDKSYTASLFAKGINKVAQKVGEEAVEIVIEAKDDHKDLFMGEAADLLFHYLVLLEAKGYELDEVMDVLIQRHKG
Hit FamilyFIG00000862
Hit Family FunctionPhosphoribosyl-AMP cyclohydrolase (EC 3.5.4.19) / Phosphoribosyl-ATP pyrophosphatase (EC 3.6.1.31)


back to search