Query Sequence
>Echvi_2459
MRTITNPTQSEWQKELARPVQKMKDIQKIVKPIMRKVSRQGDKALKKFALEYDHVEIDNLLVSRDEINEAYEQVDESLKSAIQQAKVNIEKFHKAQQTEDLSMEVMEGVTCMRRSVPIQKVGLYIPGGTAPLFSTVLMLGIPANIAGCEEIVLCTPPNKEGKIHPAILYTANLIGIDKIVKAGGAQAIAALTYGTESVPQVAKIFGPGNQYVTAAKQLATKKGIAIDMPAGPSEVLVYADESAVPAFVAADLLSQAEHGIDSQVILVATASKVAKKTLKEVDKQLAKLPRKDIAKKALENSIAVVMGNQEKAIALINDYAPEHLIINVANEDEVVANIVNAGSVFIGNFTPESAGDYASGTNHTLPTYGFARNYSGVSLDSFVKKITYQKITEKGLQNLGPTIEVMAGNELLDAHKNAVSIRLKYLKEK
Hit FamilyFIG00000303
Hit Family FunctionHistidinol dehydrogenase (EC 1.1.1.23)


back to search