Query Sequence
>Echvi_1734
MKFETLAIHGGEKKSAPHRAVVQPITLSTTFEHHEESLIYSRSQNPNRMALEELLAQLEKGSAAAAFSSGNAAGMAVFQALPLGSHIVAPSDMYHGLKKQLVELFKDKLEVTFTDLSDPENLEKAIQPNTKLLWIETPSNPMLKISDIRRLTKMAKEDDIRVVCDNTFATPVFQNPLELGADLVMHSATKYFGGHSDILGGALITKKSDEFWKQIVNVQQTGGAVLSPFDCYLLVRSIKTLAYRMRGHAEHAGMIATFLDQHPKVERVFYPGLTAHPGHDVAKSQMTGFGGILSFLVKGKPEDADKLISSLKYYTNATSLGGVESLIERRAAVEGPDTKTPQNLIRLSVGLEHLDDLLEDMEKAFYSIG
Hit FamilyFIG00001346
Hit Family FunctionCystathionine gamma-lyase (EC 4.4.1.1)


back to search