Query Sequence
>Echvi_1582
MDILSIENVSKIYQSGSRTLTVLEDINLSVKAGDSIAIVGPSGSGKTTLLGLCAGLDSASSGSVALNGHRLEGLSEDQRAAVRSQEIGFIFQNFQLLPTLTALENVMVPLELKKRKDAKQKATELLQQVGLGDRMTHYPTQLSGGEQQRVSIARAFANEPKILFADEPTGNLDTETGELIETLIFDLNKALGTTLILVTHDTDLAAKTNRIIHIKGGKIQEEQHA
Hit FamilyNo hits found for this sequence


back to search