Query Sequence
>Echvi_0123
MTSTPHQQKVAIQGIKGSYHYQVALNQFGQDIHVIECLTFSDLVKSITSNDADIGVLALENSIAGAILPNYDLMDRNNLQVIGEFYLPISHQLMVLKGQSIDDITEVRSHPMALLQCKAFFEQYPQIKLIEDLDTASVAKEISEQHLQGVGAIAGKSAAEFYGLDILASDIQTIKNNITRFCIVKNAADAKPVIGFDKASIKVTIKNEQGSLAKVLTTMSAYRLDLTKIQSLPVIDQPWHYAFFIDLLFENLEDYQQALKELKANGHQIKVLGEYKNTK
Hit FamilyFIG00341289
Hit Family FunctionPrephenate dehydratase (EC 4.2.1.51)


back to search