Query Sequence
>Dsui_3246
MSQFDNVSVVKAANVYFDGKCVSHTVIFADGSKKTVGVILPASLTFNTGAPEVMETVAGACRYRLKGETEWKTSGAGESFNVPGNSSFDIEVTGEPYHYVCYFG
Hit FamilyFIG00904518
Hit Family FunctionFIG074102: hypothetical protein


back to search