Query Sequence
>Dsui_3057
MSRKYFGTDGVRGRVGEAPITPDFAMRLGYSAGQVLVAQDGLPAGERPAVLIGKDTRISGYMLEAALEAGFSAAGVDVCLVGPMPTPAVAYLTRALRLQAGIVISASHNPFYDNGIKFFSAQGTKLPDAVEHAIEAGVEAPMGCVPSDRLGKARRIDDARGRYIEFCKSTFPNDLDLRGLKIVVDCAHGAAYHIAPDVFHELGADVVAIGNRPDGLNINAAVGATAPKALKEAVLGQRADLGIALDGDGDRLVMVDGEGNVYDGDQLLYAIVRGRQALGPVAGVAGTLMTNLALEDALKALDIPFARAAVGDRYVLEKLVQNGWLYGGENSGHILCLDRHTTGDGIIAALQVLAALRQQGGSLKALLGDLVLYPQKLINVPMPKGFPWQDSPAIAAAQRAVEAELDGRGRVLLRASGTEPLLRVMVEGRDGELIARLAEKLAGAVRQAVGE
Hit FamilyFIG00009682
Hit Family FunctionPhosphoglucosamine mutase (EC 5.4.2.10)


back to search