Query Sequence
>Dsui_3052
MHGGLAANRSLLQGVVAGVKGLAAAVECAVCVPYPYLAQAQQELAKTEVSWGAQNLSEQVSGAFTGEVSAAMLKDFGCRYVIVGHSERRALYGEDDGLVAKKFKQALAGGLVPILCVGETLAQRESGQAAEVVAAQLDAVLDAAGVEVFAGAVVAYEPVWAIGTGLTASPAQAQAVHEGIRARLAARNAEVAAGVRVLYGGSVKAGNAAELFAMPDIDGALVGGASLVAEEFVAICRAAAF
Hit FamilyFIG00000076
Hit Family FunctionTriosephosphate isomerase (EC 5.3.1.1)


back to search