Query Sequence
>Dsui_3029
MSDTKKFLLDGKPVVFQDGQTILEAARQAGHYIPHLCWHPDFPAHGSCKLCIVKVGGRHVSSCAMPAKEGMEVESNTPEMNGERRALLQMLFVEGNHFCPSCEKSGNCQLQALAYDLEMLSAHFNHFYPNRPVDASHPDVLLDFNRCIFCELCVRASRDIDGKNIFALTDRGIHKHLVVNAESGRLADTDFAASDRAANICPVGVILHKRQGFARPIGERDYDAKPISVVAMEEVEK
Hit FamilyFIG00128947
Hit Family FunctionNAD-reducing hydrogenase subunit HoxU (EC 1.12.1.2)


back to search