Query Sequence
>Dsui_2433
MSSSIFASVEMAPRDPILGLTEAFNADTRATKVNLGVGVYYDDNGKIPLLAAVKAAEKARLETMPPRGYQPIEGLNAYNQAVQNLLFGAGSELLAAGRVITAEALGGTGALKIGADFLKRISPNAKVYISDPSWENHRALFESAGFVVENYPYYDAATRGVNFAGMKSFLEGLAAGSIIILHACCHNPTGADLSDAQWQEVVDVCKAKGLVPFLDMAYQGFADGIDADAVAVRAFSASGLQFFVSSSFSKSFSLYGERVGALSVVTASKEESARVLSQVKRVIRTNYSNPPTHGGAVVAAVLSTPELRQMWEDELAGMRDRIRAMRVALVDKLKAKGVAQDFSFVVKQRGMFSYTGLTSAQVDVLRNEFGIYAVGTGRICLAALNSKNIDAVVDAIAAVLKA
Hit FamilyNo hits found for this sequence


back to search