Query Sequence
>Dsui_2228
MAQMMKAAVVHEFGKPLVIEEVPVPEVPPGQVLVKVVASGVCHTDLHAADGDWPVKPSLPFIPGHEGVGYVAAVGAGVTHVKEGDRVGVPWLHTACGHCEHCITGWETLCDSQQMTGYTVNGGYAEYVLADPGYVGKLPDTLEFAPAAPVLCAGVTVYKGLKVLECKPGDWVAISGIGGLGHMAVQYAKAMGFHVIAVDVADEKLALAKTLGADVTLNAARVDPVAEIQKQIKGAHGILVTAVSRSAFGQALGMLHKRGTMSLVGLPPGDFGLPIFDVVLNAKTVRGSIVGTRKDLEEALAFAGEGKVKTHYSTDRIENINDIFGRMKAGHIDGRIVLNI
Hit FamilyFIG01007502
Hit Family FunctionAlcohol dehydrogenase (EC 1.1.1.1)


back to search