Query Sequence
>Dsui_2066
MKLIRSLLVAGLALGLAAAPAFAQEKKNLTIGATAGPNFDQVKLGIKPILEKKGYSVKLVEFNDYVQPNLALAQGSLDANVFQHVIYLKKFSADKGLNLTDVVKVPVAPMGLYSKKAKSLKDVKDGDRVTLPNDPSNLARALHFLEQNGLIKVKAGIDALKATEKDVAENPRKLQLTPIEAAQLPRTLDDAGLVVVPGNFAIASGLKLSEAISLEKTPDHYLNVVAVKTEDQNKAWAQDIVAAFKSAEFKAVLDKHFQGYARPNYWQ
Hit FamilyFIG00047509
Hit Family FunctionMethionine ABC transporter substrate-binding protein


back to search