Query Sequence
>Dsui_0981
MTFSSILIEVDGPVGILTLNKPDRHNAFDETLMAEITAGLKQLEADPAVRVVVLSATGKSFCAGADLNWMKRAAGYTPEQNLADAGNLAELLRTLNTLAKPTVARVQGPAYGGGVGLVAACDVAVASYDAMFALTEVKLGLIPAVISPYVIAALGERQCRRYFLTAERFSAAEGYRLGLLHEIVPSEEQLDEAVGEIVDKLLKNGPAAQAASKELIRAVANQPIDDAVIADTARRITAMRASAEGREGIAAFLEKRKPHWITD
Hit FamilyFIG00138403
Hit Family FunctionMethylglutaconyl-CoA hydratase (EC 4.2.1.18)


back to search