Query Sequence
>CCNA_03279
MAKNPFQDKVCIVTGAASGLGRALSAQLAEAGATLIIADINFPAAEELAHRMNQLGVTAKPVRTDVTLSESVRQLIEGTAAEFGRIDYLFNNAGIAVFGEIRDLSLDHWRRVIDINLMGEIYGIHYAYPQMIKQGFGHIVNVASGFGMAPGPVNSPYVASKFAVFGLSHALATEARAFGVHVTVACPGFIKTPLVDNIHCVNAAPADVLANIPVAMVPVDRAANIILTGVAKRKMVIAFPGYVGVLAFIHRFLPAVWDSMGKGEIARFRKIRKDPAVS
Hit FamilyFIG01396261
Hit Family Functionshort chain dehydrogenase family protein


back to search