Query Sequence
>CCNA_02489
MAWTRDEMAARAARELKNGFYVNLGIGIPTLVANHIPEGVHVTLQSENGMLGMGPFPYEDEADPDLINAGKQTITKLPTSSFFDSAQSFAMIRGGHIDLTVLGAMEVAQNGDIANWTIPGKMVKGMGGAMDLVAGVKRVIVVMDHANKAGQSKVLKRCALPLTGAACVDMVITDLCVFDLDRKGGGLTLIELAPEVTLDEVKAKTAADFDAGAFA
Hit FamilyFIG01955969
Hit Family Function3-oxoadipate CoA-transferase subunit B (EC 2.8.3.6); Glutaconate CoA-transferase subunit B (EC 2.8.3.12)


back to search