Query Sequence
>CCNA_01972
MSLEPAFDAFSEAYDSGRQQVVWTRLIDDLETPVSAYLKIAQARPYSFLFESVEGGAWRGRYSIVTMNPDLVWRCRGDQAEIAEGDDIAAGRFTPQPGGALDSLRDLVARSRMDLPKGLPPMAAGVFGALGYDLVRLVERLPDVNPDALNLPDGIMTRPSIVAVFDAIAQEIILTTTVRPQAGVSAKAAHDAARARIEAVMADLHRPLAHDAPRPPRGPMDFTTPVSRADYAEVVAKAKDYIAAGDIFQVVASHRFRAPFDLPPFALYRSLRRTNPSPFLFFLNLDGFNLVGSSPEILVRLRDGKITIRPIAGTRPRGATPEEDAALEAELLADPKERAEHLMLLDLGRNDVGRVAMLNHHGRNAPPEQARPKGPNVRVTESFTIERYSHVMHIVSNVEGTAPEGVDPVDVLMAALPAGTLSGAPKVRAMEIIDELEVEKRGISYAGAVGYFGADGAVDTCIVLRTALVKDGMMYVQAGGGIVADSDPDAEYDETLHKSRALKRAAEEAWRFS
Hit FamilyFIG00011663
Hit Family FunctionAnthranilate synthase, aminase component (EC 4.1.3.27)


back to search