Query Sequence
>CCNA_01907
MALLSFRNVWVEYGDKVVLENVELSIAQGSFVSIVGPSGAGKSTFLRLVIGQEAPTRGAIDLEGRNLRAEPGPDRGVVFQKYSVFPHLSARDNVVFGLDCAGSALRGKLSGAKRRAALEQADAMLAAVGLGDSGDLYPAKMSGGMQQRLAIAQALIKKPRILLLDEPFGALDPGVRLDMHELITSLWRDNGLTIMMVTHDIKEAFKLGTRVLAFDKRRRDPHAPHRYGATAVYDFPLDKPGAVGPEALAGLGQ
Hit FamilyFIG00229367
Hit Family FunctionUrea carboxylase-related ABC transporter, ATPase protein


back to search