Query Sequence
>CCNA_01684
MSGDGLSNGPPPGARPDWTIDQGWETYTQAEHDVWITLYERQTDMLHGRACDEFMRGLDALDLHRSGIPDFARINEELKRLTGWTVVAVPGLVPDDVFFDHLANRRFPAGQFIRKPHELDYLQEPDIFHDVFGHVPMLTDPVFADYMQAYGEGGRRALGLGRLANLARLYWYTVEFGLMNTPAGLRIYGAGIVSSRTESIFALDDPSPNRIGFDLERVMRTLYRIDDFQQVYFVIDSIQTLQEVTLRDFGAIYERLASVSDIGVAEIVPGDAVLTRGTQAYATAGGRLAGAAAG
Hit FamilyFIG00001792
Hit Family FunctionPhenylalanine-4-hydroxylase (EC 1.14.16.1)


back to search