Query Sequence
>CCNA_01161
MAATQTKSSRFISGFGAQVLIAMVAGLGLGLLARQLGPAEGQAGYVLAETLRQVGQIFVQLLRVLVPPLVFTAIVASIANIAQMQNAARLVWRTLFWFAVTALISVVIGIALGLVLQPGLHASLDAAAAKAPKTHGSWLDFLTGLVPVNILGLAASTKISDAGAASTSLSFNVLQIVVISLVTGVAALKVGEAGEAFLKFNASALAIVRKVLWWVIRLTPIGTVGLFGNAVAQYGWTTLGQLGAFTVAIYAGLGLVLLVVYPVLLALNDLNPIRFFQGAWPAIQLAFVSRSSIGTLPVTETVTETRLGVPRAYAAFAVPLGATTKMDGCAAIYPAIAAIFVAQFFGVHLVWSDYLLIVFVSVIGSAATAGLTGATVMLTLTLSTLGLPLEGAGLLLAIDPILDMGRTAVNVAGQALVPTLVAKREGILDLEAYNRPGSHADAAFHAAE
Hit FamilyFIG00008055
Hit Family FunctionProton/glutamate symport protein @ Sodium/glutamate symport protein


back to search