Query Sequence
>CCNA_00105
MTEANLAVNFFVALFALIDPIGNVPLFAAATLGAAAAGRRMVAVYIGLFMAAFLIFFYFTGVGLLEFFGISMPAFRIAGGIILFILGLDMVRDDFTTMFADAAEGIEDQSPRAYAKQRFERLIVPFAMPLLIGPGSISTVIIYAAEAKDFGAAGMGIGVAVIAAVSLVTVLTFWASPLVSKVLGRIGMSIVVRVLGLILCALAVQFVLVGVADATRGLIKNDAKAPYAESHK
Hit FamilyFIG00480890
Hit Family Functionmembrane protein, MarC family protein


back to search