Query Sequence
>CA265_RS25430
MAKILVTGGTGYIGSHTAVELHNAGYEVVIVDNLSNSNIKILTQLHAITGKWFDFHEIDLQDDRAVQEFAENHTDIDGIIHFAASKAVGESVEQPLKYYKNNFYGLINLLTSFNRKINFVFSSSCTVYGQPETLPVTEAAPVQKAESPYGNTKQIAEEILAETAAVTPALNIIALRYFNPVGAHETALIGELPNGVPANLVPFITQSAIGKRGPITVYGDDYDTPDGSAIRDYIHVVDLAKAHVAAIKKLEEGNPNGNYDVFNIGTGKGSSVLEIIAAFEKVNGEKLDYKIGPRRAGDIVQIYGDVQKSNNELGWKANLDINEMMRSAWEWEKYIKANPF
Hit FamilyFIG00022300
Hit Family FunctionUDP-glucose 4-epimerase (EC 5.1.3.2)


back to search