Query Sequence
>CA265_RS25075
MFKLRINKIINQPGDNITFQFEEVDEPYPKYLAGQFISLIFQGKHKEIRRSYSFNSSPDVDEPLSITVKRVENGEISRFLHHKTSVNDILLAQEPQGMFSYLPDENLERDLFLFAAGVGITPLFSILKTALVREKKSLVTLVYSNRSMEDALFYDELSEWQKKYPERLKIVWVFSNSKNLMTARLNKFYIEKLLKEHLHFDRNDALFYSCGPIIYMDLCRITLLGVGFDIKQIKRETFVLPEDEVDEDDGSAEKVVDKNTYSVVLNFKGEIYHLDVPWPKRILDVALENKIKLPYSCRGGVCSTCVANCTKGGVRMDYNEVLTDDELERGRVLVCTGHPTENGTTIAW
Hit FamilyFIG01281286
Hit Family FunctionFlavodoxin reductases (ferredoxin-NADPH reductases) family 1


back to search