Query Sequence
>CA265_RS24650
MLEILPTSDSGLPTKIKACLFDLDGVLVDTAVYHYKAWKRLANTMGFDFTEEQNEQLKGVSRVESLNKILAWGGIEKTDSEKDELAGLKNSWYVDMITKMTPAEVLPGTVDFLTAIHKAGYKLALGSASKNSGIILEKTDLAHFFDKIVDGNMVTKSKPDPEVFLKGAELLGFAPDECVVFEDAVAGVEAAKRGGMKAIGIGEKSVLTQADVVVSGLDKLTVKDLEEL
Hit FamilyFIG01960938
Hit Family FunctionBeta-phosphoglucomutase (EC 5.4.2.6)


back to search