Query Sequence
>CA265_RS23295
MIEDKANSKTENSRRNFIKTTALAAAGFMIVPRHVLGGPGFLAPSDRLQLAGIGAGGKGESDIASIVRGGKTDVAFLCDVDDRRAANSLKNFPKAKYYKDYRELLDKEGKNIDAVTVSTPDHTHAQIAMAAMQLGKHVYVQKPLTHDIYEARMLTEAANRYKVVTQMGNQGASGDGVRRLQEWYDAGRIGKVHTVYCWTNRPVWPQGISWPTGKAEIPKELDWDLWLGSAPYKEYVNKLVPFNWRGWWDYGTGAIGDMGCHLVEPPFRVLGLDTPISVECSVGSVYVDEFKRAYLPESCPPSSHVILTFAKTPKTKHEVQVHWMDGGIKPERPEELGPNESFGDNGVLFIGTKGKMICETYGKNPKLLPLSRNESDKTKITIPRIANQEEGHYTQFAEAAIAGYGKMELSSPFEIAGPLTETLLIANLAIRGTDVQRRDAAGKISYPGRDIKMLWDKVKMKVTNFDEVNQFVKREYRKGWTLGV
Hit FamilyFIG00896676
Hit Family FunctionProbable NADH-dependent dehydrogenase


back to search