Query Sequence
>CA265_RS23025
MKINFFKYQGAGNDFILIDHTMSPLKNIDNQLVEQLCHRRFGIGADGLMFITKHEDYDFEMHYFNADGKLGSMCGNGGRCIVAFAKQLGIIDRETNFLAVDGPHYARISENGEWVDLQMIDVDTITKDGEAYILNTGSPHYVALQSDLKDFDVFTAGKNIRYNATYAEKGINVNFVEDKGDHLFVRTYERGVEDETYACGTGVTAVAMAMAKHKNQTGHIKTAIKVLGGDIKIEFDYDGKEFTNVFLCGPAKLVFEGEVE
Hit FamilyFIG00000421
Hit Family FunctionDiaminopimelate epimerase (EC 5.1.1.7)


back to search