Query Sequence
>CA265_RS22390
MHQNEIKDVEYRLKSIFGGSVGNLVEWYDWYTYSAFALYFSPAFFPNSNPTAQLLDTAGIFAVGFLMRPIGGWLFGSIADKLGRKRSMTLSVLIMAIGSLIIGLTPGYKQIGIAAPLLLIFARLIQGLSTGGEYGTSATYLSEMATKKHRGFYSSFQYVTLIGGQLLALGIQLILQNWLLTPAELHEWGWRIPFFIGAILSFIALYLRRHIDETSAFKSKNTADKKGGIAVLMKYPKEVFTVVGLTLGGTIAFYTFSTYMQKFLVNTVHLSKETSTTLSFISLLVFVVLQPLFGLLSDKIGRKPLLIGFGVLGTLCTYPILTGLAGESNTTIIFLLMIGALIIVSGYTSINAVVKAELFPAEIRALGVGLPYALTVAIFGGTAEYFALWFKNIGHENYFYWYVTGCILISLILYTTMKDTKHHSKIED
Hit FamilyNo hits found for this sequence


back to search