Query Sequence
>CA265_RS19860
MSNKHKILDAILEQGMLPLFYQDSESGSVEILRTLYKAGVRVFEYTNRGKSALPNFKKLKEIRDAEMPDLYLGIGTIKTPADANAFIEAGTDFIVAPIVNPAVAEIANKIGMLWIPGCMTPTEISVAQEHKAMLIKIFPANILGPEFISSIKDLFAGQLFMPTGGVEINADNLKTWFKSGVCAVGMGSKLISKDVMSKGLYEELFDNTKLALDLIQQSK
Hit FamilyFIG00000591
Hit Family Function4-Hydroxy-2-oxoglutarate aldolase (EC 4.1.3.16) @ 2-dehydro-3-deoxyphosphogluconate aldolase (EC 4.1.2.14)


back to search